1
/
의
1
AntibodySystem
SKU(재고 관리 코드):RGK26103
Anti-Twin-Strep-tag Antibody (SAA0348)
Anti-Twin-Strep-tag Antibody (SAA0348)
Catalog No.: RGK26103
| Catalog No. | RGK26103 |
|---|---|
| Product name | Anti-Twin-Strep-tag Antibody (SAA0348) |
| Size | 100 μg |
| Species reactivity | General |
| Host species | Mouse |
| Isotype | IgG2b |
| Applications | ELISA, WB |
| Form | Liquid |
| Storage buffer | 100 mM Pro-Ac, 20 mM Arg, pH 5.0 |
| Purity | >95% as determined by SDS-PAGE. |
| Clonality | Monoclonal |
| Target | Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK |
| Purification | Protein A/G purified from cell culture supernatant. |
| Endotoxin level | Please contact with the lab for this information. |
| Stability and Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term. |
| Clone ID | SAA0348 |
| Note | For research use only. |
Share
