제품 정보로 건너뛰기
1 의 1

Elabscience

SKU(재고 관리 코드):PKSS000001

Recombinant Swine IL-1 alpha protein(N-His)(active)

Recombinant Swine IL-1 alpha protein(N-His)(active)

가격·납기 및 기술자료를 확인해 드립니다.

제품 규격과 수량을 선택한 후 견적을 요청해 주세요. 대체품 검토와 SDS·COA·데이터시트 요청도 함께 접수할 수 있습니다.

이 제품 견적 요청

대표번호 070-8028-3500 · info@rndmate.com

MULTI-BRAND QUOTE
여러 제품을 함께 찾고 계신가요?
제조사가 달라도 괜찮습니다. 필요한 연구시약을 한 번에 견적받아보세요.
통합 견적 요청
Size
Fusion tag

Sequence : MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNQKSFYDASYEPLPGDGMDKFMPLSTSKTSKTSRLNFKDSVVMAAANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

Introducing the Recombinant Swine IL-1 alpha protein(N-His)(active), a highly advanced and meticulously engineered product that offers unparalleled efficacy in the field of swine immunology. This protein, derived from recombinant technology, showcases exceptional purity and activity, making it an indispensable tool for researchers and scientists alike.

The Recombinant Swine IL-1 alpha protein(N-His)(active) is specifically designed to stimulate and modulate immune responses in swine, thereby facilitating a deeper understanding of the intricate mechanisms underlying swine immunology. With its active form, this protein exhibits enhanced functionality, ensuring accurate and reliable results in various experimental settings.

Crafted with utmost precision, this product boasts a superior level of purity, guaranteeing minimal interference and maximum efficacy. Its N-His tag further facilitates easy detection and purification, streamlining laboratory procedures and expediting research progress.

The Recombinant Swine IL-1 alpha protein(N-His)(active) is meticulously manufactured in compliance with stringent quality control measures, ensuring consistent and reproducible results. Its exceptional stability and long shelf life make it an ideal choice for long-term experiments and storage.

In summary, the Recombinant Swine IL-1 alpha protein(N-His)(active) stands as a cutting-edge solution for researchers seeking to unravel the complexities of swine immunology. With its unrivaled purity, activity, and stability, this product is poised to revolutionize the field, enabling groundbreaking discoveries and advancements in swine health and disease research.

전체 세부 정보 보기