Elabscience
SKU(재고 관리 코드):PKSS000001
Recombinant Swine IL-1 alpha protein(N-His)(active)
Recombinant Swine IL-1 alpha protein(N-His)(active)
Sequence : MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNQKSFYDASYEPLPGDGMDKFMPLSTSKTSKTSRLNFKDSVVMAAANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS
Introducing the Recombinant Swine IL-1 alpha protein(N-His)(active), a highly advanced and meticulously engineered product that offers unparalleled efficacy in the field of swine immunology. This protein, derived from recombinant technology, showcases exceptional purity and activity, making it an indispensable tool for researchers and scientists alike.
The Recombinant Swine IL-1 alpha protein(N-His)(active) is specifically designed to stimulate and modulate immune responses in swine, thereby facilitating a deeper understanding of the intricate mechanisms underlying swine immunology. With its active form, this protein exhibits enhanced functionality, ensuring accurate and reliable results in various experimental settings.
Crafted with utmost precision, this product boasts a superior level of purity, guaranteeing minimal interference and maximum efficacy. Its N-His tag further facilitates easy detection and purification, streamlining laboratory procedures and expediting research progress.
The Recombinant Swine IL-1 alpha protein(N-His)(active) is meticulously manufactured in compliance with stringent quality control measures, ensuring consistent and reproducible results. Its exceptional stability and long shelf life make it an ideal choice for long-term experiments and storage.
In summary, the Recombinant Swine IL-1 alpha protein(N-His)(active) stands as a cutting-edge solution for researchers seeking to unravel the complexities of swine immunology. With its unrivaled purity, activity, and stability, this product is poised to revolutionize the field, enabling groundbreaking discoveries and advancements in swine health and disease research.