Recombinant Swine IL-1 beta protein(N-His)(active)

Sequence : MAIVPEPAKEVMANYGDNNNDLLFEADGPKEMKCCTQNLDLGSLRNGSIQLQISHQLWNKSIRQMVSVIVAVEKPMKNPSSQAFCDDDQKSIFSFIFEEEPIILETCNDDFVCDANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP

Introducing the Recombinant Swine IL-1 beta protein(N-His)(active), a cutting-edge product meticulously engineered to revolutionize the field of swine immunology. This highly advanced protein, derived from recombinant technology, showcases exceptional purity and activity, ensuring optimal performance in various research applications.

Crafted with utmost precision, the Recombinant Swine IL-1 beta protein(N-His)(active) boasts a superior level of quality, making it an indispensable tool for scientists and researchers alike. Its active form guarantees accurate and reliable results, enabling comprehensive investigations into the intricate mechanisms of swine immune responses.

With its N-His tag, this protein offers enhanced versatility, facilitating effortless purification and detection. This attribute significantly streamlines experimental procedures, saving valuable time and resources. Moreover, the Recombinant Swine IL-1 beta protein(N-His)(active) exhibits remarkable stability, ensuring prolonged shelf life and consistent performance throughout its usage.

This groundbreaking product opens up new avenues for in-depth studies on swine immunology, enabling researchers to unravel the complexities of immune regulation and inflammatory processes in swine species. Its unrivaled potency and reliability make it an indispensable asset in the quest for advancements in veterinary medicine and animal health.

In conclusion, the Recombinant Swine IL-1 beta protein(N-His)(active) stands as a pinnacle of scientific innovation, offering an unparalleled opportunity to delve into the intricacies of swine immune responses. Its exceptional purity, activity, and versatility make it an indispensable tool for researchers seeking to unravel the mysteries of swine immunology and drive progress in the field of veterinary medicine.