Elabscience
SKU(재고 관리 코드):PKSS000011
Recombinant Swine BMP-4 protein(N-His)
Recombinant Swine BMP-4 protein(N-His)
Sequence : MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQTHSVGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPPEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Introducing the Recombinant Swine BMP-4 protein (N-His), a cutting-edge product meticulously developed to cater to the diverse needs of the scientific community. This protein, derived from swine, has been produced using advanced recombinant technology, ensuring its utmost purity and efficacy.
The Recombinant Swine BMP-4 protein (N-His) holds immense potential in various research applications, particularly in the field of regenerative medicine. With its ability to induce bone formation and promote tissue regeneration, this protein serves as a valuable tool for investigating the intricate mechanisms underlying skeletal development and repair.
Crafted with utmost precision, the Recombinant Swine BMP-4 protein (N-His) exhibits exceptional stability and bioactivity, guaranteeing reliable and reproducible results. Its N-terminal histidine tag facilitates easy purification and detection, streamlining experimental procedures and enhancing overall efficiency.
Furthermore, this product adheres to the highest quality standards, ensuring its suitability for a wide range of experimental setups. Its consistent performance and exceptional purity make it an indispensable asset for researchers seeking to unravel the complexities of bone biology and tissue engineering.
In summary, the Recombinant Swine BMP-4 protein (N-His) stands as a remarkable scientific advancement, offering researchers an invaluable tool to delve into the intricacies of skeletal development and tissue regeneration. With its exceptional purity, stability, and bioactivity, this protein is poised to revolutionize the field of regenerative medicine and contribute to groundbreaking discoveries in the realm of bone biology.
Introducing the Recombinant Swine BMP-4 protein (N-His), a cutting-edge product that revolutionizes the field of biotechnology. This meticulously engineered protein is derived from swine sources and is produced using recombinant DNA technology, ensuring the highest level of purity and quality.
The Recombinant Swine BMP-4 protein (N-His) is a potent growth factor that plays a crucial role in various biological processes, particularly in bone and cartilage development. With its ability to induce osteogenesis and chondrogenesis, this protein holds immense potential in regenerative medicine, tissue engineering, and drug discovery.
Our product stands out due to its exceptional purity, as it is meticulously purified using advanced chromatographic techniques. This ensures the removal of any impurities, resulting in a highly concentrated and biologically active protein. Furthermore, the inclusion of the N-His tag facilitates easy detection and purification of the protein, simplifying experimental procedures.
The Recombinant Swine BMP-4 protein (N-His) is supplied in lyophilized form, ensuring long-term stability and ease of storage. Each vial contains a precisely measured amount of protein, allowing for accurate and reproducible experiments. Additionally, our product is accompanied by comprehensive documentation, including a certificate of analysis, ensuring traceability and quality assurance.
Whether you are a researcher in the field of regenerative medicine, a scientist involved in tissue engineering, or a pharmaceutical company seeking novel drug targets, the Recombinant Swine BMP-4 protein (N-His) is an indispensable tool for your endeavors. Its exceptional purity, biological activity, and ease of use make it a valuable asset in advancing scientific knowledge and driving innovation.
Choose the Recombinant Swine BMP-4 protein (N-His) and unlock the potential of this remarkable growth factor in your research and development endeavors. Experience the power of cutting-edge biotechnology and elevate your scientific pursuits to new heights.