1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):RQ4625
ACTN3 Antibody / Alpha Actinin 3
ACTN3 Antibody / Alpha Actinin 3
Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Purified |
| Clone | 9B5 |
| Host Animal | Mouse |
| Clonality | Monoclonal (mouse origin) |
| Isotype | Mouse IgG1 |
| Species Reactivity | Mouse, Rat |
| Application | WB, IHC-P |
| Application Details | Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml |
| Application Note | Optimal dilution of the ACTN3 antibody should be determined by the researcher. |
| Localization | Cytoplasmic, extracellular |
| Immunogen | Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK were used as the immunogen for the ACTN3 antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| Purity | Protein G affinity |
| Storage | After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Uniprot # | Q08043 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/actn3-antibody-alpha-actinin-3-9b5-rq4625 |
| Title | ACTN3 Antibody / Alpha Actinin 3 |
| Description | Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. |
Share
