제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):RQ4625

ACTN3 Antibody / Alpha Actinin 3

ACTN3 Antibody / Alpha Actinin 3

Size

Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Purified
Clone 9B5
Host Animal Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Species Reactivity Mouse, Rat
Application WB, IHC-P
Application Details Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
Application Note Optimal dilution of the ACTN3 antibody should be determined by the researcher.
Localization Cytoplasmic, extracellular
Immunogen Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK were used as the immunogen for the ACTN3 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Protein G affinity
Storage After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Uniprot # Q08043
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/actn3-antibody-alpha-actinin-3-9b5-rq4625
Title ACTN3 Antibody / Alpha Actinin 3
Description Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
전체 세부 정보 보기