제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):R32460

ACVR2B Antibody / ActRIIB

ACVR2B Antibody / ActRIIB

Size

Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Rat
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Optimal dilution of the ACVR2B antibody should be determined by the researcher.
Immunogen Amino acids VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE from the human protein were used as the immunogen for the ACVR2B antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.005% sodium azide
Purity Antigen affinity
Storage Prior to reconstitution, store at 4oC. After reconstitution, the ACVR2B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This ACVR2B antibody is available for research use only.
Uniprot # Q13705
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/acvr2b-antibody-actriib-r32460
Title ACVR2B Antibody / ActRIIB
Description Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
전체 세부 정보 보기