NSJ Bioreagents
SKU(재고 관리 코드):R32460
ACVR2B Antibody / ActRIIB
ACVR2B Antibody / ActRIIB
Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Rat |
| Application | WB |
| Application Details | Western blot: 0.5-1ug/ml |
| Application Note | Optimal dilution of the ACVR2B antibody should be determined by the researcher. |
| Immunogen | Amino acids VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE from the human protein were used as the immunogen for the ACVR2B antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.005% sodium azide |
| Purity | Antigen affinity |
| Storage | Prior to reconstitution, store at 4oC. After reconstitution, the ACVR2B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This ACVR2B antibody is available for research use only. |
| Uniprot # | Q13705 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/acvr2b-antibody-actriib-r32460 |
| Title | ACVR2B Antibody / ActRIIB |
| Description | Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. |
Share
