1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):R31869
AHSG Antibody / Fetuin-A
AHSG Antibody / Fetuin-A
Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Rat |
| Application | WB, IHC-P, FACS, ELISA (protein) |
| Application Details | Western blot: 0.1-0.5ug/ml,IHC (FFPE): 0.5-1ug/ml,FACS: 1-3ug/10^6 cells,ELISA: 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating |
| Application Note | Optimal dilution of the AHSG antibody should be determined by the researcher. |
| Localization | Secreted |
| Immunogen | Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the AHSG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This AHSG antibody is available for research use only. |
| Uniprot # | P02765 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/ahsg-antibody-fetuin-a-r31869 |
| Title | AHSG Antibody / Fetuin-A |
| Description | Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. |
Share
