제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):R31869

AHSG Antibody / Fetuin-A

AHSG Antibody / Fetuin-A

Size

Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Rat
Application WB, IHC-P, FACS, ELISA (protein)
Application Details Western blot: 0.1-0.5ug/ml,IHC (FFPE): 0.5-1ug/ml,FACS: 1-3ug/10^6 cells,ELISA: 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating
Application Note Optimal dilution of the AHSG antibody should be determined by the researcher.
Localization Secreted
Immunogen Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the AHSG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This AHSG antibody is available for research use only.
Uniprot # P02765
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/ahsg-antibody-fetuin-a-r31869
Title AHSG Antibody / Fetuin-A
Description Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
전체 세부 정보 보기