1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):RQ4911
AKR1D1 Antibody / Aldo-keto reductase family 1 member D1
AKR1D1 Antibody / Aldo-keto reductase family 1 member D1
Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB, FACS |
| Application Details | Western blot: 0.5-1ug/ml,FACS: 1-3ug/10^6 cells |
| Application Note | Optimal dilution of the AKR1D1 antibody should be determined by the researcher. |
| Immunogen | Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein were used as the immunogen for the AKR1D1 antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the AKR1D1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This AKR1D1 antibody is available for research use only. |
| Uniprot # | P51857 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/akr1d1-antibody-aldo-keto-reductase-family-1-member-d1-rq4911 |
| Title | AKR1D1 Antibody / Aldo-keto reductase family 1 member D1 |
| Description | Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. |
Share
