1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):R32683
Annexin VIII Antibody
Annexin VIII Antibody
ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human |
| Application | WB, FACS |
| Application Details | Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/10^6 cells |
| Application Note | Optimal dilution of the Annexin VIII antibody should be determined by the researcher. |
| Immunogen | Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This Annexin VIII antibody is available for research use only. |
| Uniprot # | P13928 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/annexin-viii-antibody-r32683 |
| Title | Annexin VIII Antibody |
| Description | ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10. |
Share
