1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):R32271
ARC Antibody / Activity-regulated cytoskeleton-associated protein
ARC Antibody / Activity-regulated cytoskeleton-associated protein
Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB |
| Application Details | Western blot: 0.1-0.5ug/ml |
| Application Note | Optimal dilution of the ARC antibody should be determined by the researcher. |
| Immunogen | Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This ARC antibody is available for research use only. |
| Uniprot # | Q7LC44 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/arc-antibody-activity-regulated-cytoskeleton-associated-protein-r32271 |
| Title | ARC Antibody / Activity-regulated cytoskeleton-associated protein |
| Description | Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience. |
Share
