제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):R32513

ARHGEF1 Antibody

ARHGEF1 Antibody

Size

Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB, IHC-P, IF, FACS
Application Details Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note Differences in protocols and secondary/substrate sensitivity may require the ARHGEF1 antibody to be titrated for optimal performance.
Localization Cytoplasmic, membranous
Immunogen Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This ARHGEF1 antibody is available for research use only.
Uniprot # Q92888
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/arhgef1-antibody-r32513
Title ARHGEF1 Antibody
Description Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
전체 세부 정보 보기