1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):RQ6040
ATP11C Antibody / Phospholipid-transporting ATPase IG
ATP11C Antibody / Phospholipid-transporting ATPase IG
ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human |
| Application | WB, IF, FACS |
| Application Details | Western blot: 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells |
| Application Note | Optimal dilution of the ATP11C antibody should be determined by the researcher. |
| Localization | Cytoplasmic, plasma membrane |
| Immunogen | Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein were used as the immunogen for the ATP11C antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| Purity | Affinity purified |
| Storage | After reconstitution, the ATP11C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This ATP11C antibody is available for research use only. |
| Uniprot # | Q8NB49 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/atp11c-antibody-phospholipid-transporting-atpase-ig-rq6040 |
| Title | ATP11C Antibody / Phospholipid-transporting ATPase IG |
| Description | ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1. |
Share
