제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):RQ4555

C Reactive Protein Antibody / CRP

C Reactive Protein Antibody / CRP

Size

C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human
Application WB, IHC-P
Application Details Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml
Application Note Optimal dilution of the C Reactive Protein antibody should be determined by the researcher.
Localization Cytoplasmic, extracellular
Immunogen Amino acids QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA were used as the immunogen for the C Reactive Protein antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Antigen affinity purified
Storage After reconstitution, the C Reactive Protein antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This C Reactive Protein antibody is available for research use only.
Uniprot # P02741
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/c-reactive-protein-antibody-crp-rq4555
Title C Reactive Protein Antibody / CRP
Description C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.
전체 세부 정보 보기