1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):RQ4145
Carboxypeptidase A Antibody
Carboxypeptidase A Antibody
Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Mouse, Rat |
| Predicted Species Reactivity | Human |
| Application | WB |
| Application Details | Western Blot: 0.5-1ug/ml |
| Application Note | Optimal dilution of the Carboxypeptidase A antibody should be determined by the researcher. |
| Immunogen | Amino acids KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD from the human protein were used as the immunogen for the Carboxypeptidase A antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the Carboxypeptidase A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This Carboxypeptidase A antibody is available for research use only. |
| Uniprot # | P15085 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/carboxypeptidase-a-antibody-rq4145 |
| Title | Carboxypeptidase A Antibody |
| Description | Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer. |
Share
