제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):R32687

CD119 Antibody / IFNGR1

CD119 Antibody / IFNGR1

Size

Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human
Application WB, FACS
Application Details Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note Optimal dilution of the CD119 antibody should be determined by the researcher.
Immunogen Amino acids 108-147 (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) from the human protein were used as the immunogen for the CD119 antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the CD119 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This CD119 antibody is available for research use only.
Uniprot # P15260
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/cd119-antibody-ifngr1-r32687
Title CD119 Antibody / IFNGR1
Description Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
전체 세부 정보 보기