제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):RQ4650

CD229 Antibody / Ly9

CD229 Antibody / Ly9

Size

T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application IHC-P, FACS
Application Details IHC (FFPE): 1-2ug/ml,FACS: 1-3ug/10^6 cells
Application Note Optimal dilution of the CD229 antibody should be determined by the researcher.
Localization Plasma membrane, cytoplasm
Immunogen Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK were used as the immunogen for the CD229 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Antigen affinity purified
Storage After reconstitution, the CD229 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Uniprot # Q9HBG7
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/cd229-antibody-ly9-rq4650
Title CD229 Antibody / Ly9
Description T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.
전체 세부 정보 보기