1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):RQ4329
CEP68 Antibody
CEP68 Antibody
Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB |
| Application Details | Western blot: 0.5-1ug/ml |
| Application Note | Optimal dilution of the CEP68 antibody should be determined by the researcher. |
| Localization | Cytoplasm, cytoskeleton |
| Immunogen | Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the CEP68 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This CEP68 antibody is available for research use only. |
| Uniprot # | Q76N32 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/cep68-antibody-rq4329 |
| Title | CEP68 Antibody |
| Description | Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function. |
Share
