1
/
의
1
NSJ Bioreagents
SKU(재고 관리 코드):RQ4415
CHRNA3 Antibody
CHRNA3 Antibody
After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB, FACS |
| Application Details | Western blot: 0.5-1ug/ml,FACS: 1-3ug/10^6 cells |
| Application Note | Optimal dilution of the CHRNA3 antibody should be determined by the researcher. |
| Immunogen | Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the CHRNA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This CHRNA3 antibody is available for research use only. |
| Uniprot # | P32297 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/chrna3-antibody-rq4415 |
| Title | CHRNA3 Antibody |
| Description | After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt] |
Share
