제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):R32368

Connexin 46 Antibody / GJA3

Connexin 46 Antibody / GJA3

Size

Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB
Application Details Western blot: 0.1-0.5ug/ml
Application Note Optimal dilution of the Connexin 46 antibody should be determined by the researcher.
Immunogen Amino acids TLIYLGHVLHIVRMEEKKKEREEEEQLKRE of human GJA3/Connexin 46 were used as the immunogen for the Connexin 46 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the Connexin 46 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This Connexin 46 antibody is available for research use only.
Uniprot # Q9Y6H8
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/connexin-46-antibody-gja3-r32368
Title Connexin 46 Antibody / GJA3
Description Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).
전체 세부 정보 보기