• Western blot testing of 1) rat brain, 2) rat testis, 3) human HeLa lysate with Cryptochrome I antibody. Predicted/observed molecular weight ~66 kDa.
1 1

NSJ Bioreagents

R32242

Cryptochrome I Antibody

Cryptochrome I Antibody

Size

This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Rat
Application WB, IHC-P
Application Details Western blot: 0.1-0.5ug/ml,IHC (FFPE): 1-2ug/ml
Application Note Optimal dilution of the Cryptochrome I antibody should be determined by the researcher.
Localization Nuclear and cytoplasmic
Immunogen Amino acids FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK of human Cryptochrome I were used as the immunogen for the Cryptochrome I antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the Cryptochrome I antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This Cryptochrome I antibody is available for research use only.
Uniprot # Q16526
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/cryptochrome-i-antibody-r32242
Title Cryptochrome I Antibody
Description This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.
전체 세부 정보 보기