제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):RQ4345

CTR1 Antibody / Copper transporter 1

CTR1 Antibody / Copper transporter 1

Size

High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Optimal dilution of the CTR1 antibody should be determined by the researcher.
Localization Cell membrane
Immunogen Amino acids NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ were used as the immunogen for the CTR1 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Antigen affinity purified
Storage After reconstitution, the CTR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This CTR1 antibody is available for research use only.
Uniprot # O15431
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/ctr1-antibody-copper-transporter-1-rq4345
Title CTR1 Antibody / Copper transporter 1
Description High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.
전체 세부 정보 보기