제품 정보로 건너뛰기
1 1

NSJ Bioreagents

SKU(재고 관리 코드):RQ6592

Cytochrome P450 Reductase Antibody / POR / CYPOR

Cytochrome P450 Reductase Antibody / POR / CYPOR

Size

POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Clone 7F5
Host Animal Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Species Reactivity Human
Application WB, IHC-P, FACS
Application Details Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note Optimal dilution of the Cytochrome P450 Reductase antibody should be determined by the researcher.
Localization Cytoplasmic, cell membrane
Immunogen C-terminal region amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK from the human protein were used as the immunogen for the Cytochrome P450 Reductase antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity purified
Storage After reconstitution, the Cytochrome P450 Reductase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This Cytochrome P450 Reductase antibody is available for research use only.
Uniprot # P16435
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/cytochrome-p450-reductase-antibody-por-cypor-7f5-rq6592
Title Cytochrome P450 Reductase Antibody / POR / CYPOR
Description POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
전체 세부 정보 보기